Mouse Anti-KLF2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-22993P

• Product Name:
• Mouse Anti-KLF2 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human KLF2 aa 1-56 (N terminal). NP_057354 Sequence: MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILS MGLDGL

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid