Cat#:FPA-22665P;Product Name:Mouse Anti-KIAA0317 Polyclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment (GST-tag) corresponding to Human KIAA0317 aa 24-123. This immunogen contains a sequence conflict at amino acid 114, where a T is substituted with a N. Sequence: ELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSCKVSWDWKDPYEVG HSMAFRVHLFYKNGQPFPAHRP;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment (GST-tag) corresponding to Human KIAA0317 aa 24-123. This immunogen contains a sequence conflict at amino acid 114, where a T is substituted with a N. Sequence: ELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSCKVSWDWKDPYEVG HSMAFRVHLFYKNGQPFPAHRP
Species Reactivity:
Human Predicted to work with: Mouse
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.