Mouse Anti-Kallikrein 12 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-12602M

• Product Name:
• Mouse Anti-Kallikrein 12 Monoclonal Antibody

• Formulation:
• Lyophilised:Reconstitute the antibody with 500 µL sterile PBS.

• Host Species:
• Mouse

• Immunogen:
• Recombinant full length protein corresponding to Human Kallikrein 12 AA 18-247. This product is for the mature full length protein. The signal peptide is not included. Sequence: ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSR YWVRLGEHSLSQLDWTEQIRHSGFSV

• Species Reactivity:
• Human

• Clone#:
• LL9678-5P51

• Isotype:
• IgG2

• Application:
• ELISA, Neutralising, WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal