Cat#:FPA-21896P;Product Name:Mouse Anti-IRX1 Polyclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment (GST-tag) corresponding to Human IRX1 aa 424-479 (C terminal). NP_077313 Sequence: NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRI LAALPS ;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment (GST-tag) corresponding to Human IRX1 aa 424-479 (C terminal). NP_077313 Sequence: NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRI LAALPS
Species Reactivity:
Human Predicted to work with: Mouse
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.