• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Interferon gamma Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-12327M
  • Product Name:
  • Mouse Anti-Interferon gamma Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Full length native protein (purified) corresponding to Human Interferon gamma AA 24-161. (Derived from Human leukocytes). Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELS
  • Species Reactivity:
  • Human, Non human primates
  • Clone#:
  • 3R.A2
  • Isotype:
  • IgG1
  • Application:
  • Flow Cyt
  • Storage Buffer:
  • pH: 7.40 Preservative: 0.0975% Sodium azide Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-Interferon gamma Monoclonal Antibody-FPA-12326M
  • Online Inquiry

    refresh