• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Integrin beta 4 binding protein Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-21594P
  • Product Name:
  • Mouse Anti-Integrin beta 4 binding protein Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fragment (proprietary-tag) corresponding to Human Integrin beta 4 binding protein aa 146-245. (NP_002203). Sequence: VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAA GMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituent: 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Integrin beta 4 binding protein Polyclonal Antibody-FPA-21593P
  • Online Inquiry

    refresh