• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Integrin alpha 3b Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-12149M
  • Product Name:
  • Mouse Anti-Integrin alpha 3b Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.
  • Species Reactivity:
  • Human Predicted to work with: a wide range of other species
  • Clone#:
  • 43A2
  • Isotype:
  • IgG1
  • Application:
  • WB, IHC-Fr, ICC
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-Integrin alpha 3a Monoclonal Antibody-FPA-12148M
  • Online Inquiry

    refresh