Mouse Anti-Integrin alpha 3b Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-12149M

• Product Name:
• Mouse Anti-Integrin alpha 3b Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.

• Species Reactivity:
• Human Predicted to work with: a wide range of other species

• Clone#:
• 43A2

• Isotype:
• IgG1

• Application:
• WB, IHC-Fr, ICC

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid