Mouse Anti-GPCR GPR86 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-9803M

• Product Name:
• Mouse Anti-GPCR GPR86 Monoclonal Antibody

• Formulation:
• There are 2 isoforms produced by alternative splicing.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human GPCR GPR86 AA 1-49 (N terminal). Sequence: MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPA

• Species Reactivity:
• Human

• Clone#:
• 5F1D19

• Isotype:
• IgG1

• Application:
• Flow Cyt, WB

• Positive control:
• Human GPCR GPR86 (amino acids 1-49) recombinant protein. Lysate from HEK293 cells transfected with GPCR GPR86 (amino acids 1-49). HeLa cells.

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal