Cat#:FPA-9777M;Product Name:Mouse Anti-GORASP2 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human GORASP2 AA 203-276. Sequence: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGI EQSLTGLSISSTPPAVSSVLSTGV ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Clone#:BK1411;Isotype:IgG1;Application:IHC-P, WB;Positive control:U251 cell lysate; Human small intestine, cerebral cortex, prostate and fallopian tube tissues.;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;