Cat#:PA-2764F;Product Name:Mouse Anti-Glucagon-Like Peptide (GLP1) Antibody;Synonym:GCG; Gcg; GLP 1; GLP 2; GLP2; glucagon; Glucagon like peptide 1; GRPP; Glucagon-like peptide-1; GLP-1; OTTMUSP00000013741; OTTMUSP00000013742; glucagon-like peptide I; glicentin-related polypeptide; GLP1; glucagon-like peptide 2; Glicentin-related polypeptide; Glucagon-like peptide 1(7-37); Glucagon-like peptide 1(7-36); GLP-1(7-37); GLP-1(7-36);Background:Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.;Description:Mouse Anti-Glucagon-Like Peptide (GLP1) Monoclonal Antibody;Host Species:Mouse;Species Reactivity:Human;Clone#:ID/GLP-1/29;Isotype:IgG1;Application:IHC;Storage:Store antibody products at 2-8°C. For long term storage, aliquot and freeze at -20°C. Avoid repeated freeze/thaw cycles;Usage:For Lab Research Use Only;
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.