Cat#:FPA-9417M;Product Name:Mouse Anti-GDF8 / Myostatin Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human GDF8/ Myostatin AA 24-266. Recombinant fragment correspondingn to propeptide domain of human GDF8/ Myostatin expressed in E coli Sequence: NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNIS KDVIRQLLPK APPLRELIDQ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Goat, Horse, Chicken, Cow, Dog, Pig;Clone#:5D3A1;Isotype:IgG2b;Application:IHC-P, WB, Flow Cyt;Positive control:Human GDF8 / Myostatin (AA:24-266 ) recombinant protein; LNcap cell lysate; LNcap cells; Human cervical cancer tissue and Human liver cancer tissue.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;