Cat#:FPA-9352M;Product Name:Mouse Anti-GC1q R Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human GC1q R AA 74-282 (C terminal). NCBI Accession No. NP_001203. Purified from E. coli. Sequence: LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRK VAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVI KNDDGKKALVLDCHY;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, African green monkey;Clone#:ZS1F6;Isotype:IgG1;Application:WB;Positive control:Recombinant Human GC1q R protein. HeLa, Jurkat, MCF7, Ramos, 293T and A549 cell lysates.;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 89% PBS, 10% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;