Mouse Anti-GAB1 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-9100M

• Product Name:
• Mouse Anti-GAB1 Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human GAB1 AA 661-724 (C terminal). Expressed in E. Coli. Sequence: DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDG RQSTESETPAKSVK

• Species Reactivity:
• Human Predicted to work with: Mouse, Hamster, Cow

• Clone#:
• 4E11B7

• Isotype:
• IgG1

• Application:
• WB, Flow Cyt

• Positive control:
• GAB1 (aa 661-724)-hIgGFc transfected HEK293 cell lysate; Recombinant Human GAB1 protein (aa 661-724); HeLa cells.

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.