Cat#:FPA-9011M;Product Name:Mouse Anti-Fructose 6 Phosphate Kinase Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Fructose 6 Phosphate Kinase AA 1-780. Sequence: MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFF VHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLR AAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEA;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig, Cynomolgus monkey, Orangutan;Clone#:ZS1E11;Isotype:IgG2a;Application:WB;Positive control:HepG2 lysate.;Storage Buffer:pH: 7.40 Preservative: 0.01% Sodium azide Constituents: 10% Glycerol, 89% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;