Mouse Anti-Fibronectin Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-8744M

• Product Name:
• Mouse Anti-Fibronectin Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human Fibronectin AA 1631-1721. Sequence of the type III repeats termed EIIIA (or ED-A). Sequence: NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP DGEEDTAELQ GLRPGSEYTVSVVALHDDMESQPLIGTQSTA

• Species Reactivity:
• Rat, Chicken, Cow, Dog, Human, Pig, Monkey Predicted to work with: Mouse, Rabbit

• Clone#:
• HRS-8

• Isotype:
• IgG1

• Application:
• WB, RIA, ELISA, IHC-Fr, ICC/IF, Other, Blocking, IHC-P

• Positive control:
• normal foetal lung fibroblasts (cell line MRC5), skin, rat or human kidney (see reviews)

• Storage Buffer:
• Constituent: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid