• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Estrogen Related Receptor gamma Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-14038P
  • Product Name:
  • Mouse Anti-Estrogen Related Receptor gamma Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Full length protein corresponding to Human Estrogen Related Receptor gamma aa 1-435. Mature Estrogen Related Receptor gamma Sequence: MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMN GHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSM PKRLCLVCGDIASGYHYGV
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • pH: 7.2 Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-Estrogen Related Receptor gamma Polyclonal Antibody-FPA-14037P
  • Online Inquiry

    refresh