Mouse Anti-Ephrin B2 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-8040M

• Product Name:
• Mouse Anti-Ephrin B2 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (His-tag) corresponding to Human Ephrin B2 AA 1-227. Partial extracellular domain with Fc and His tags (NP_004084.1). Sequence: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVL YPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN CAKP

• Species Reactivity:
• Human Predicted to work with: Mouse

• Clone#:
• OZ2381732

• Isotype:
• IgG1

• Application:
• IHC-P, WB

• Positive control:
• Human liver Hepatocarcinoma tissue; COLO 205 cell lysate; Ephrin B2 Fc-His tag recombinant protein

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid