• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-ELL2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-13300P
  • Product Name:
  • Mouse Anti-ELL2 Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fragment (GST-tag) corresponding to Human ELL2 aa 253-352. Note: this sequence contains a natural variant at aa 298 where an A is substituted with a T. Sequence: SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSR SESPVCSSRDAVSSPQKRLLDSEFIDPLMN
  • Species Reactivity:
  • Human Predicted to work with: Mouse
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ELL2 Polyclonal Antibody-FPA-13299P
  • Online Inquiry

    refresh