Mouse Anti-ELL2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-13300P

• Product Name:
• Mouse Anti-ELL2 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human ELL2 aa 253-352. Note: this sequence contains a natural variant at aa 298 where an A is substituted with a T. Sequence: SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSR SESPVCSSRDAVSSPQKRLLDSEFIDPLMN

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid