Cat#:FPA-7711M;Product Name:Mouse Anti-EGFR Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human EGFR AA 693-893. Expressed in E. Coli. Sequence: TPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPV AIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQL MPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARN VLVKTPQHV;Species Reactivity:Human Predicted to work with: Mouse;Clone#:4D19C2;Isotype:IgG2b;Application:WB, Flow Cyt;Positive control:A431 and HeLa cell lysates; Human EGFR recombinant protein; HEK293 cell lysate, transfected with EGFR (amino acids 693-893)-hIgGFc.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS Contains 0.5% protein stabilizer.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;