Mouse Anti-Dlp Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11857P

• Product Name:
• Mouse Anti-Dlp Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Fusion protein: GIDAIEIPQKPSNERVLRYCESPSVGTCCTYNMETRMAMQSRQQLEGHTK DQISRM , corresponding to aa 91/146 of Fruit fly (Drosophila melanogaster) Dlp

• Species Reactivity:
• Drosophila melanogaster

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid