Cat#:FPA-5921M;Product Name:Mouse Anti-COMP Monoclonal Antibody;Formulation:Lyophilised:Lyophilized samples are stable for 2 years from date of receipt when stored at -70°C. Reconstitute the antibody with 500 uL sterile PBS and the final concentration is 200 ug/mL. Reconstituted antibody can also be aliquoted and stored frozen at;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human COMP AA 21-757. Sequence: QGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAF AKANKQVCTDINECETGQHNC;Species Reactivity:Human;Clone#:G1.1E2;Isotype:IgG2;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;