Mouse Anti-Collagen VI alpha 2 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-5902M

• Product Name:
• Mouse Anti-Collagen VI alpha 2 Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human Collagen VI alpha 2 AA 595-1019. Note: this sequence contains a natural variant at amino acid 680, where a R is substituted with a H. Sequence: MTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFV INVV NRLGAIA

• Species Reactivity:
• Human Predicted to work with: Mouse

• Clone#:
• JO1

• Isotype:
• IgG2a

• Application:
• IHC-P, Sandwich ELISA, WB

• Positive control:
• 293T cell lysate transfected with Collagen VI alpha 2; Human Spleen tissue.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.