Mouse Anti-Collagen II Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-5891M

• Product Name:
• Mouse Anti-Collagen II Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Full length native protein (purified) corresponding to Chicken Collagen II AA 78-1100. Purified preparation of lathyritic Collagen II from embryonic chicken sternum. Sequence: QYDPSKAADFGPGPMGLMGPRGPPGASGPPGPPGFQGVPGEPGEPGQTGP QGPRGPPGPPGKAGEDGHPGKPGRPGER

• Species Reactivity:
• Mouse, Rat, Chicken, Cow, Human

• Clone#:
• DOQ281X

• Isotype:
• IgG2a

• Application:
• Flow Cyt, ICC/IF, WB, IHC-P

• Positive control:
• Human lung tissue.

• Storage Buffer:
• pH: 7.4 Preservative: 0.09% Sodium azide Constituents: 0.2% BSA, 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.