Cat#:FPA-8314P;Product Name:Mouse Anti-cetA Polyclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Fusion protein: SVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDERAQGVINELSS ETELNLAKEFIKDNAKKAIEESSQDYIDQKAYDAIVNDIKSLEQRSAEIL , corresponding to aa 355/454 of Campylobacter jejuni methyl-accepting chemotaxis protein. ;Species Reactivity:Reacts with Campylobacter jejuni. Not yet tested in ohter species.;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.;
Fusion protein: SVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDERAQGVINELSS ETELNLAKEFIKDNAKKAIEESSQDYIDQKAYDAIVNDIKSLEQRSAEIL , corresponding to aa 355/454 of Campylobacter jejuni methyl-accepting chemotaxis protein.
Species Reactivity:
Reacts with Campylobacter jejuni. Not yet tested in ohter species.
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 50% Glycerol
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.