• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-cetA Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-8314P
  • Product Name:
  • Mouse Anti-cetA Polyclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Mouse
  • Immunogen:
  • Fusion protein: SVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDERAQGVINELSS ETELNLAKEFIKDNAKKAIEESSQDYIDQKAYDAIVNDIKSLEQRSAEIL , corresponding to aa 355/454 of Campylobacter jejuni methyl-accepting chemotaxis protein.
  • Species Reactivity:
  • Reacts with Campylobacter jejuni. Not yet tested in ohter species.
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Pre product:Rabbit Anti-CES6 Polyclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh