Cat#:FPA-5368M;Product Name:Mouse Anti-CDKN2A/p16INK4a Monoclonal Antibody;Formulation:There are 4 isoforms produced by alternative splicing. Isoform 1 also known as: p16INK4a; Isoform 3 also known as: p12; Isoform 4 also known as: p14ARF; p19ARF; ARF.;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human CDKN2A/p16INK4a AA 1-156. Sequence: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Clone#:L137;Isotype:IgG1;Application:IHC-P, WB, Flow Cyt;Positive control:Recombinant human CDKN2A protein; CDKN2A transfected HEK293 cells; HeLa, HepG2, HEK293 cell lysate; HeLa cells; human endometrial cancer tissue; human esophageal cancer tissue.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;