Mouse Anti-CBX4 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-2859M

• Product Name:
• Mouse Anti-CBX4 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide corresponding to Human CBX4 AA 8-65 (N terminal). Sequence: EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAF QNRERQEQ

• Species Reactivity:
• Human Predicted to work with: Mouse

• Clone#:
• DOQ11833(A)

• Isotype:
• IgG1

• Application:
• IP, MS

• Positive control:
• HEK293 cells.

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.

• Clonality:
• Monoclonal

• Form:
• Liquid