• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-CBX4 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-2859M
  • Product Name:
  • Mouse Anti-CBX4 Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Synthetic peptide corresponding to Human CBX4 AA 8-65 (N terminal). Sequence: EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAF QNRERQEQ
  • Species Reactivity:
  • Human Predicted to work with: Mouse
  • Clone#:
  • DOQ11833(A)
  • Isotype:
  • IgG1
  • Application:
  • IP, MS
  • Positive control:
  • HEK293 cells.
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-CBX2 Monoclonal Antibody-FPA-2858M
  • Online Inquiry

    refresh