Cat#:FPA-2562M;Product Name:Mouse Anti-cAMP Protein Kinase Catalytic subunit Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human cAMP Protein Kinase Catalytic subunit AA 1-120 (N terminal). (Purified from E.coli). Sequence: MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTL GTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVN FPFLVKLEFSFKDN;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Cow, Dog, Pig, Chinese hamster;Clone#:F6;Isotype:IgG1;Application:WB;Positive control:Human PRKACA (aa1-120) recombinant protein; PRKACA (aa1-120)-hIgGFc transfected HEK293 cell lysate.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;