Cat#:FPA-5482M;Product Name:Mouse Anti-c-Fos Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human c-Fos AA 1-380. purified from E. coli. Sequence: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFC TDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA PSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKM;Species Reactivity:Mouse, Human Predicted to work with: Rat, Cow, Pig;Clone#:193;Isotype:IgG1;Application:IHC-FoFr, IHC-P, WB, ICC/IF;Positive control:HeLa cells and HeLa cells serum starved for 36 hrs and then treated with 20% FBS for 2 hrs. Neural cultures and mixed neural cultures; Mouse brain tissue, Mouse cortical tissue.;Storage Buffer:Preservative: 0.03% Sodium azide Constituent: 100% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;