Mouse Anti-C5R1 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-2363M

• Product Name:
• Mouse Anti-C5R1 Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN , corresponding to N terminal amino acids 1-31 of Human C5R1.

• Species Reactivity:
• Human

• Clone#:
• NW-7

• Isotype:
• IgG2a

• Application:
• Flow Cyt, WB, IHC-Fr, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.