• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-C5R1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-2363M
  • Product Name:
  • Mouse Anti-C5R1 Monoclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Mouse
  • Immunogen:
  • Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN , corresponding to N terminal amino acids 1-31 of Human C5R1.
  • Species Reactivity:
  • Human
  • Clone#:
  • NW-7
  • Isotype:
  • IgG2a
  • Application:
  • Flow Cyt, WB, IHC-Fr, IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Pre product:Rat Anti-C5R1 Monoclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh