Mouse Anti-beta Defensin 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4324P

• Product Name:
• Mouse Anti-beta Defensin 3 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Full length protein corresponding to Human beta Defensin 3 aa 1-67. Sequence: MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRVRGGRCAVLSCLPKEE QIGKCSTRGRKCCRRKK

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.2 Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid