Product finder
Cat#:FPA-1845M;Product Name:Mouse Anti-beta Defensin 1 Monoclonal Antibody;Host Species:Mouse ;Immunogen:Synthetic peptide: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK , corresponding to amino acids 1-36 of Human beta 1 Defensin. ;Species Reactivity:Human Predicted to work with: Chimpanzee, Baboon, Macaque monkey;Clone#:DOQ5111;Isotype:IgG1;Application:ELISA, WB, IHC-P;Storage Buffer:Preservative: None Constituents: 50mM Tris HCl. pH 7.4;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Mouse Anti-beta Defensin 1 Monoclonal Antibody
Online Inquiry
- Product Name:
- Mouse Anti-beta Defensin 1 Monoclonal Antibody
- Immunogen:
- Synthetic peptide: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK , corresponding to amino acids 1-36 of Human beta 1 Defensin.
- Species Reactivity:
- Human Predicted to work with: Chimpanzee, Baboon, Macaque monkey
- Application:
- ELISA, WB, IHC-P
- Storage Buffer:
- Preservative: None Constituents: 50mM Tris HCl. pH 7.4
- Storage Procedures:
- Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Pre product:Mouse Anti-RPTP mu Monoclonal Antibody-FPA-18459M
Next product:Rabbit Anti-RPUSD3 Monoclonal Antibody-FPA-18460M