• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-beta Defensin 1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-1845M
  • Product Name:
  • Mouse Anti-beta Defensin 1 Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Synthetic peptide: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK , corresponding to amino acids 1-36 of Human beta 1 Defensin.
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Baboon, Macaque monkey
  • Clone#:
  • DOQ5111
  • Isotype:
  • IgG1
  • Application:
  • ELISA, WB, IHC-P
  • Storage Buffer:
  • Preservative: None Constituents: 50mM Tris HCl. pH 7.4
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-RPTP mu Monoclonal Antibody-FPA-18459M
  • Online Inquiry

    refresh