Mouse Anti-beta Amyloid Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4264P

• Product Name:
• Mouse Anti-beta Amyloid Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide within Human beta Amyloid aa 670-700 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: KMDAEFRHDSGYEVHHQKLVFFAEDVGSNKG

• Species Reactivity:
• Rat, Human Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Pig, Cynomolgus monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol Aqueous buffered solution

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid