Mouse Anti-ATP6V0D2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-3543P

• Product Name:
• Mouse Anti-ATP6V0D2 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human ATP6V0D2 aa 238-306. NP_689778 Sequence: ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGK TLEDVFYEREVQMNVLAFN

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal