Cat#:FPA-238M;Product Name:Mouse Anti-Aconitase 2 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Aconitase 2 AA 1-780. Produced in HEK293T cells. NP_001089. Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEK NINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQD ATAQMAMLQFISSGLSKVAVPSTIHCDH;Species Reactivity:Mouse, Rat, Human, Non human primates;Clone#:6F3;Isotype:IgG1;Application:IHC-P, WB, ICC/IF;Positive control:293T, A549, Jurkat, A431, MCF7, HeLa, U205, COS7, 3T3L1 and NRK whole cell lysates; HeLa cells; Human colon, myocardial, hepatic and renal cell carcinoma tissues; Aconitase 2 transfected MCF7 cells.;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 69% PBS, 0.1% BSA, 30% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;