Cat#:FPA-065P;Product Name:Mouse Anti-14-3-3 Tau Polyclonal Antibody;Host Species:Mouse ;Immunogen:Fusion protein corresponding to Mouse 14-3-3 Tau aa 51-151. Vector coding for a partial recombinant fusion protein, corresponding to aa 51-151 of Mouse 14-3-3 Tau. Sequence: VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL LDKYLIANATNPESKVFYLKMKGDYFRYLA;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Chicken, Cow, Human, Xenopus laevis, Cynomolgus monkey, Orangutan;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 50% Glycerol, Whole serum;Storage Procedures:Store at -20°C. Stable for 12 months at -20°C.;
Mouse Anti-14-3-3 Tau Polyclonal Antibody
Online Inquiry
Cat#:
FPA-065P
Product Name:
Mouse Anti-14-3-3 Tau Polyclonal Antibody
Host Species:
Mouse
Immunogen:
Fusion protein corresponding to Mouse 14-3-3 Tau aa 51-151. Vector coding for a partial recombinant fusion protein, corresponding to aa 51-151 of Mouse 14-3-3 Tau. Sequence: VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL LDKYLIANATNPESKVFYLKMKGDYFRYLA
Species Reactivity:
Mouse Predicted to work with: Rat, Rabbit, Chicken, Cow, Human, Xenopus laevis, Cynomolgus monkey, Orangutan