• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-14-3-3 Tau Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-065P
  • Product Name:
  • Mouse Anti-14-3-3 Tau Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Fusion protein corresponding to Mouse 14-3-3 Tau aa 51-151. Vector coding for a partial recombinant fusion protein, corresponding to aa 51-151 of Mouse 14-3-3 Tau. Sequence: VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL LDKYLIANATNPESKVFYLKMKGDYFRYLA
  • Species Reactivity:
  • Mouse Predicted to work with: Rat, Rabbit, Chicken, Cow, Human, Xenopus laevis, Cynomolgus monkey, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: None Constituents: 50% Glycerol, Whole serum
  • Storage Procedures:
  • Store at -20°C. Stable for 12 months at -20°C.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-14-3-3 Tau Polyclonal Antibody-FPA-064P
  • Online Inquiry

    refresh