Goat Anti-TLR8 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41967P

• Product Name:
• Goat Anti-TLR8 Polyclonal Antibody

• Host Species:
• Goat

• Immunogen:
• Synthetic peptide: CESFQGLQNLTKINLNHNPNVQHQNGNPGI , corresponding to aa 81-109 of Human TLR8

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, ICC, IHC-P

• Storage Buffer:
• Preservative: 0.1% Sodium Azide Constituents: PBS, 1mg/ml BSA, 140mM Sodium chloride, 10mM Potassium phosphate, pH 7.2

• Storage Procedures:
• Upon delivery aliquot. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid