Cat#:FPA-34349P;Product Name:Goat Anti-PTHLH Polyclonal Antibody;Host Species:Goat ;Immunogen:Synthetic peptide: KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP , corresponding to aa 53-86 of Human PTHLH. ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:RIA;Storage Buffer:Preservative: None Constituents: Whole Serum;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.;