• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Goat Anti-Parathyroid Hormone Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-30858P
  • Product Name:
  • Goat Anti-Parathyroid Hormone Polyclonal Antibody
  • Host Species:
  • Goat
  • Immunogen:
  • Synthetic peptide corresponding to Human Parathyroid Hormone aa 1-38. Human PTH (aa 12-17; 1-34; 1-38; 1-84). Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • Functional Studies, RIA
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Parathyroid Hormone Polyclonal Antibody-FPA-30857P
  • Online Inquiry

    refresh