Goat Anti-Parathyroid Hormone Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-30858P

• Product Name:
• Goat Anti-Parathyroid Hormone Polyclonal Antibody

• Host Species:
• Goat

• Immunogen:
• Synthetic peptide corresponding to Human Parathyroid Hormone aa 1-38. Human PTH (aa 12-17; 1-34; 1-38; 1-84). Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• Functional Studies, RIA

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid