Goat Anti-Lactate Dehydrogenase Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23366P

• Product Name:
• Goat Anti-Lactate Dehydrogenase Polyclonal Antibody

• Host Species:
• Goat

• Immunogen:
• Full length native protein (purified) corresponding to Rabbit Lactate Dehydrogenase aa 2-332. (Isolated from rabbit muscle). Sequence: AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALV DVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQ EGESRLNLVQRNVNIFKF

• Species Reactivity:
• Rabbit, Human Predicted to work with: Mammal

• Isotype:
• IgG

• Application:
• IP, WB

• Storage Buffer:
• pH: 7.20 Preservative: 0.01% Sodium azide Constituents: 0.87% Sodium chloride, 0.42% Potassium phosphate

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid