Goat Anti-DcR1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11173P

• Product Name:
• Goat Anti-DcR1 Polyclonal Antibody

• Host Species:
• Goat

• Immunogen:
• Synthetic peptide: EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC , corresponding to N terminal aa 33-64 of Human DcR1.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• ELISA, Flow Cyt, ICC, WB

• Storage Buffer:
• PBS, 1mg/ml BSA, 0.1% sodium azide, pH7.2

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid