• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Goat Anti-DcR1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-11173P
  • Product Name:
  • Goat Anti-DcR1 Polyclonal Antibody
  • Host Species:
  • Goat
  • Immunogen:
  • Synthetic peptide: EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC , corresponding to N terminal aa 33-64 of Human DcR1.
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • ELISA, Flow Cyt, ICC, WB
  • Storage Buffer:
  • PBS, 1mg/ml BSA, 0.1% sodium azide, pH7.2
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-DcR1 Polyclonal Antibody-FPA-11172P
  • Online Inquiry

    refresh