Goat Anti-CGRP Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-8386P

• Product Name:
• Goat Anti-CGRP Polyclonal Antibody

• Host Species:
• Goat

• Immunogen:
• Synthetic peptide: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF , corresponding to C terminal aa 82-118 of Human CGRP.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• RIA

• Storage Buffer:
• Preservative: None Constituents: Whole Serum

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid