Goat Anti-CD40L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-7619P

• Product Name:
• Goat Anti-CD40L Polyclonal Antibody

• Formulation:
• Lyophilised:Reconstitute the antibody in 100 ul sterile water. The reconstituted antibody is stable for at least 2 weeks at 2-8°C. Frozen aliquots are stable for at least 6 months when stored at -20°C.

• Host Species:
• Goat

• Immunogen:
• Recombinant fragment corresponding to Human CD40L. Produced from sera of goats pre-immunized with highly pure (>98%) recombinant Human CD40L. Sequence: MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLWLKSPGRFERILLRAANTH S

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal