• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Goat Anti-Carbonic Anhydrase I Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-6513P
  • Product Name:
  • Goat Anti-Carbonic Anhydrase I Polyclonal Antibody
  • Host Species:
  • Goat
  • Immunogen:
  • Full length native protein (purified) corresponding to Human Carbonic Anhydrase I aa 2-261. (Purified from Erythrocytes). Sequence: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS YNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGST NEHGSEHTVDGVKYSAELHVA
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB
  • Storage Buffer:
  • pH: 7.20 Preservative: 0.01% Gentamicin sulphate Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate, 1% BSA Do NOT add Sodium Azide!
  • Storage Procedures:
  • Store at 4°C.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-Carbonic Anhydrase I Polyclonal Antibody-FPA-6512P
  • Online Inquiry

    refresh