• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Goat Anti-C3c Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-5718P
  • Product Name:
  • Goat Anti-C3c Polyclonal Antibody
  • Formulation:
  • Cleaved into the following 10 chains: 1) Complement C3 beta chain 2) Complement C3 alpha chain 3) C3a anaphylatoxin 4) Complement C3b alpha' chain 5) Complement C3c alpha' chain fragment 1 6) Complement C3dg fragment 7) Complement C3g fragment 8) Compleme
  • Host Species:
  • Goat
  • Immunogen:
  • Full length native protein (purified) corresponding to Rabbit C3c aa 1-726. C3c is isolated and purified from pooled normal rabbit serum. Sequence: MNKTVAVRTLDPENLGQGGVQKEEIPSADISDQVPGTESETKILLQGTPV AQMTEDAIDGERLKHLIVTGSGCGEQNMIAMTHTVIAVHYLDHTEQWDKF SLEKR
  • Species Reactivity:
  • Rabbit
  • Isotype:
  • IgG
  • Application:
  • IP
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Pre product:Goat Anti-C3c Polyclonal Antibody-FPA-5717P
  • Online Inquiry

    refresh