Goat Anti-C3c Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5718P

• Product Name:
• Goat Anti-C3c Polyclonal Antibody

• Formulation:
• Cleaved into the following 10 chains: 1) Complement C3 beta chain 2) Complement C3 alpha chain 3) C3a anaphylatoxin 4) Complement C3b alpha' chain 5) Complement C3c alpha' chain fragment 1 6) Complement C3dg fragment 7) Complement C3g fragment 8) Compleme

• Host Species:
• Goat

• Immunogen:
• Full length native protein (purified) corresponding to Rabbit C3c aa 1-726. C3c is isolated and purified from pooled normal rabbit serum. Sequence: MNKTVAVRTLDPENLGQGGVQKEEIPSADISDQVPGTESETKILLQGTPV AQMTEDAIDGERLKHLIVTGSGCGEQNMIAMTHTVIAVHYLDHTEQWDKF SLEKR

• Species Reactivity:
• Rabbit

• Isotype:
• IgG

• Application:
• IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal