Goat Anti-Antithrombin III Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2329P

• Product Name:
• Goat Anti-Antithrombin III Polyclonal Antibody

• Formulation:
• Lyophilised:Reconstitute the lyophilized antiserum by adding 1 ml sterile distilled water. If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance of the antiserum.

• Host Species:
• Goat

• Immunogen:
• Full length native protein (purified) corresponding to Human Antithrombin III aa 33-464. (Isolated and highly purified from pooled plasma). Sequence: HGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQ QLM

• Species Reactivity:
• Human Predicted to work with: Mouse, Sheep, Cow, Orangutan

• Isotype:
• IgG

• Application:
• IP, Immunodiffusion

• Storage Buffer:
• No preservative added. No foreign proteins added.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal