Chicken Anti-PON1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33050P

• Product Name:
• Chicken Anti-PON1 Polyclonal Antibody

• Host Species:
• Chicken

• Immunogen:
• Fusion protein: MYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIV, corresponding to aa 125-170 of PON1

• Species Reactivity:
• Human

• Isotype:
• IgY

• Application:
• WB, ICC/IF

• Storage Buffer:
• Preservative: None Constituents: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid