• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Chicken Anti-PON1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-33050P
  • Product Name:
  • Chicken Anti-PON1 Polyclonal Antibody
  • Host Species:
  • Chicken
  • Immunogen:
  • Fusion protein: MYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIV, corresponding to aa 125-170 of PON1
  • Species Reactivity:
  • Human
  • Isotype:
  • IgY
  • Application:
  • WB, ICC/IF
  • Storage Buffer:
  • Preservative: None Constituents: PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-PON1 Polyclonal Antibody-FPA-33049P
  • Online Inquiry

    refresh