• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Chicken Anti-BRCA1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-4785P
  • Product Name:
  • Chicken Anti-BRCA1 Polyclonal Antibody
  • Host Species:
  • Chicken
  • Immunogen:
  • Synthetic peptide: QQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE DLRNPEQSTSEKAV , corresponding to aa 1395-1454 of Human BRCA1.
  • Species Reactivity:
  • Human
  • Isotype:
  • IgY
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: 0.02% Sodium Azide Constituents: PBS
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-BRCA1 Polyclonal Antibody-FPA-4784P
  • Online Inquiry

    refresh