Cat#:PA-2766F;Product Name:Rabbit Anti-Human GCG Antibody;Synonym:GCG; glucagon; GLP1; GLP2; GRPP;Background:Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.;Description:Rabbit Anti-Human GCG Polyclonal Antibody;Formulation:Liquid Solution;Host Species:Rabbit;Species Reactivity:Human;Application:RIA;Storage:Store antibody products at 2-8°C. For long term storage, aliquot and freeze at -20°C. Avoid repeated freeze/thaw cycles;Usage:For Lab Research Use Only;