Cat#: | FPA-48587P |
Product Name: | Rabbit Anti-SYT8 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human SYT8 aa 5-44 (N terminal). Sequence: HGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGT Database link: Q8NBV8 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol |