• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-MCP1 Polyclonal Antibody Online Inquiry

Cat#:FPA-47565P
Product Name:Rabbit Anti-MCP1 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Recombinant full length protein corresponding to Equus MCP1 aa 24-99. Sequence: QPDAINSPVTCCYTFTGKKISSQRLGSYKRVTSSKCPKEAVIFKTILAKE ICADPEQKWVQDAVKQLDKKAQTPKP Database link: Q9TTQ3 Run BLAST with Run BLAST with
Species Reactivity: Horse
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Preservative: 0.09% Sodium azide Constituent: 99% PBS

Online Inquiry

refresh