Cat#: | FPA-47565P |
Product Name: | Rabbit Anti-MCP1 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant full length protein corresponding to Equus MCP1 aa 24-99. Sequence: QPDAINSPVTCCYTFTGKKISSQRLGSYKRVTSSKCPKEAVIFKTILAKE ICADPEQKWVQDAVKQLDKKAQTPKP Database link: Q9TTQ3 Run BLAST with Run BLAST with |
Species Reactivity: | Horse |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: 0.09% Sodium azide Constituent: 99% PBS |